Illusion chimera deck May 1, 2024 · Don't forget to LIKE, COMMENT and SUBSCRIBENew videos Wednesday, Friday and Sunday FOLLOW ON TWITCH - https://twitch. Their theme’s Fusion Spell is Chimera Fusion, which can be used to Fusion Summon any monster using at least 1 Beast or This is an easy guide for chimera illusion deck in yugioh master duelwhere i will show you step by step how to play chimera illusion and do chimera combos an Apr 27, 2024 · I would like to show you one of the decks that I call Illusion-Chimera . Database, Deck Builder and Collection Manager app. com/ZEPHYR5Your 1 Chimera the Illusion Beast. TCG April 2024 Phantom Beast, Chimera, HERO Deck by SkywardSpork · 45 cards · 15 Extra Deck · 13 Side Deck · #Rogue, #Budget Jun 9, 2024 · Chimera Illusion is a REALLY GOOD & fun Yugioh deck! I'll provide a basic deck profile and show off some combos in case you're interested in picking it up yo Master Duel Decks PSY-Frame "C" Chimera 40 TCGplayer $217. tv/mbtyu Apr 12, 2024 · Don't forget to LIKE, COMMENT and SUBSCRIBENew videos Wednesday, Friday and Sunday FOLLOW ON TWITCH - https://twitch. Tournament: The 18th Tulio CS - July 29th 2023. By Samuel Frew | Published 8/5/2023 | 5 min read. "Chimera the Flying Mythical Beast" + 1+ Illusion monsters<br />This card's name becomes "Chimera the Flying Mythical Beast" while on the field or in the GY. Deck Quimera con monstruos Ilusión con el soporte introducido en La Era del Señor Supremo. This card can attack monsters a number of times each Battle Phase, up to the number of materials used for it. No deck type has been provided. Now you are able to summon your Chimera the Illusion Magical Beast. Dado que "Quimera, la Bestia de Ilusión" requiere de "Quimera, la Bestia Voladora Mítica" como principal material, se podrá conseguir su Invocación Especial mediante "Chimera the Flying Mythical Beast" + 1+ Illusion monsters This card's name becomes "Chimera the Flying Mythical Beast" while on the field or in the GY. Nov 2, 2023 · If this card is Normal or Special Summoned: You can add 1 Level 5 Fiend monster or 1 "Chimera Fusion" from your Deck to your hand. com/collections/supremepro-sleeves Buy This DECK HERE: 👉 http://bit. 53 120 30 510 810 Purchase Deck Playtest ¿Qué hace Chimera Illusion? En este gameplay, te mostraré algunas partidas de Chimera Illusion Deck Master Duel. Illusion Chimera with or without Melodious, deck is INSANELY powerful and looks good for the future too! Highly recommend!100k Celebration Giveaway: https:// Decks; Fun/Casual Decks; Beast Chimera Illusion; Beast Chimera Illusion. This card can attack monsters a number of times each Battle Phase, up to the number of materials used for it. 70 / Cardmarket €134. As long as the Graveyard is alive you can do a lot of plays. 09 120 30 210 540 Purchase Deck Playtest Aug 9, 2023 · If this card is Normal or Special Summoned: You can add 1 Level 5 Fiend monster or 1 "Chimera Fusion" from your Deck to your hand. gg/4QtwRSfF4YFollow: TikTok: https://www. + 1 Magnum the Reliever + 1 Chimera the King of Phantom Beasts + 1 Fiendsmith's Requiem + 1 Apollousa, Bow of the Goddess + 3 Infinite Impermanence + 1 Guardian Chimera + 1 Evil HERO Adusted Gold + 3 Ash Blossom & Joyous Spring + 1 Chaos Angel + 2 Gazelle the King of Mythical Claws + 2 Polymerization + 1 Called by the Grave + 2 Triple Tactics Total Estimated Deck Price: This tool attempts to find the lowest Market Price for each card on . Both engines fall into the Sinful Nov 18, 2024 · #yugiohcards #yugioh #yugiohmasterduel #yugiohtcg MASTER DUEL | CHIMERAGeas of the LightNew Selection PackCHIMERA master duelCHIMERA deck 2024CHIMERA deck Hello my friend and I duel at work all the time he recently topped a local and he runs Illusion chimera. patreon. Tournament Meta Decks are current-level Meta Decks that are capable of going up against the best of the best. 86 120 90 480 990 Purchase Deck Playtest Meta Decks Edge Imp Chimera 40 TCGplayer $253. Non-Meta Decks Runick Edge Imp Exchange of Decklist https://ygoprodeck. The engine/deck itself is similiar to Branded with the same weaknesse. domainformat. com/deck/illusion-chimera-domain-format-383903https://www. But it can work really well as a budget deck and is easy to learn. Nightmare Apprentice helps with consistency to Chimera and any future Illusion Decks. Non-Meta Decks Millennium Djinn Chimera 60 TCGplayer $137. Aug 8, 2023 · Ultimately, the Illusion Chimera cards aim to Fusion Summon monsters that treat themselves as Chimera the Flying Mythical Beast, such as the new Berfomet the Phantom Beast Dark Ruler (YGOrg Translation), and each carries an effect to banish themselves from the GY to Special Summon a Beast, Fiend, or Illusion monster during your opponent’s turn. 155 views. This is more of a second going card idea and you don't have to play it if you don't think it's needed. Hey everyone, here's a new variant of my Illusion Chimera deck which now features both the Diabellstar and Azamina engine. 41 / Cardmarket €96. and this video wants to show you exactly that. If you are looking for a Tier 1 deck then Illusion is not the right call. At the end of the Damage Step, if this card battled an This Deck combines a lot of Illsuion Monster with the new fiendsmith engine and mixing it with the new Decktheme Azamina while also containing Chimera. TCG July 2024 Chimera, Fluffal, Branded Deck by tlm · *Inspired by Dinh-Kha Bui (Top 8 at Germany National Championship 2024) but without Triple Tactics Jun 14, 2024 · Don't forget to LIKE, COMMENT and SUBSCRIBENew videos Wednesday, Friday and Sunday FOLLOW ON TWITCH - https://twitch. in t Dec 5, 2024 · "Chimera the Flying Mythical Beast" + 1+ Illusion monsters This card's name becomes "Chimera the Flying Mythical Beast" while on the field or in the GY. Category: Tournament Meta Decks (OCG) Tournament Meta Decks are current-level Meta Decks that are capable of going up against the best of the best. tierzerogames. Buy "Chimera the Flying Mythical Beast" + 1+ Illusion monsters This card's name becomes "Chimera the Flying Mythical Beast" while on the field or in the GY. 2 Mar 31, 2025 · Extra Deck (15) 1 Super Tueur des Étoiles TY-PHON - Crise Céleste 1 Super Starslayer TY-PHON - Sky Crisis: 1 Ange du Chaos 1 Chaos Angel: 2 Gardien Chimère 2 Guardian Chimera: 1 Chimère, Bête Illusion 1 Chimera the Illusion Beast: 1 Dragostapelia Prédaplante 1 Predaplant Dragostapelia: 1 Magnum le Releveur 1 Magnum the Reliever Aug 18, 2023 · And this brings us to the second part of the deck, the Illusion Chimera side. Tournament: Super Memory Card Dabaishu – February 11th 2024. Login to join the YGOPRODeck discussion! Feb 6, 2025 · Chimera Illusion is an Aggro deck in Yu-Gi-Oh Master Duel, featuring the first set of Illusion-type monsters added to the game! Check out the core deck list, key combos, as well as how to play & counters! Without Diabellze or Nightmare Apprentice, the Illusion Deck isn't at full power in Yu-Gi-Oh Master Duel. TCG CL1 Big-Winged Berfomet to summon from GY Mirror Swordknight, CL2 Gazelle the King of Mythical Claws to search from deck any Illusion monster, CL3 Chimera the King of Phantom Beasts to send a random card from opponent's hand to the GY in the End Phase. TCG September 2024 Chimera, Phantom Beast, Fluffal Deck by tlm · 40 cards · 15 Extra Deck · 15 Side Deck · #Rogue, #Midrange, #Budget Chimera Illusion. In this deck we have multiple ways to see illusion knight. from the GY with "Chimera the King of Phantom Beasts"), such as "Nightmare Magician". Read More Read Less Toggle Master Duel View. In this article, Learn how to play with Chimera, the new fusion deck which introduces a new monster type to the game, Illusion monsters. Sep 17, 2023 · “Chimera” é o mais novo e incomum arquétipo a figurar o metagame do Yu-Gi-Oh! TCG. Editar Illusion Chimera / Stardust Card OCG Top 4 - YGOPRODeck. Chimera VS 41 cards. Kia ora! In this week's Episode Deck, we'll look at a different take on the deck Yugi used in the Battle City preliminaries! Jan 7, 2025 · You can also get Chimera the Illusion Beast from the Master Pack. Language. But with bulk common Emissary from the House of Wax and the Horus monsters, the deck can still be a lot of fun, even in Master 1. RugRat didn't specify if this deck is better at going first or second at the start of the duel. Chimera the Illusion Beast. Typically people play 1 or 2 copies of him. Sep 20, 2024 · Chimera Fusion X SPELL Quick-Play During the Main Phase: Fusion Summon 1 Fusion Monster from your Extra Deck, using monsters from your hand or field as material, including a Beast or Fiend monster. Sep 6, 2024 · Hey everyone, here's an update on my Illusion Chimera deck which no longer features the Branded engine. tv/evilwensterJoin: Discord: https://discord. Theorycrafting Decks Edge Imp Chimera Toy 41 TCGplayer $225. Decks; Non-Meta Decks; Chimera Illusion; Chimera Illusion. TierZeroGames. Deck Breakdown Jul 28, 2023 · 💎Shop TSX1 Sleeves 👉 https://tsx1. 2x. This deck uses the April 2024 TCG banlist. Aug 5, 2023 · Yu-Gi-Oh! Episode Decks: Yugi Muto's Buster Chimera Deck. The Chimera Fusion engine centers around fusing a Beast and Fiend monster together for either of the Chimera the Flying Mythical Beast stand-ins, such as Chimera the King of Phantom Beasts. com/mbtyugiohTwitter: https://twitter. com/DarkArmedDuelist?alert=2PATRONS: TIER: DARK ARMED ANNIHIATION DRAGONS!IzzyTerverion TIER: DARK ARMED DRAGON The chimera/illusion core is overall affordable, with the main Chimera boss monster being the only card in the core worth $10ish dollars. What’s the best way to beat this deck. bioPatreon: https://www. If this card is sent to the GY as material for a Fusion Summon: You can add 1 Illusion monster from your Deck to your hand. Oct 15, 2024 · TCG October 2024 Chimera, HERO, Phantom Beast Deck by Haggard · 41 cards · 15 Extra Deck · 0 Side Deck A list of Chimera Yu-Gi-Oh! decks from the Yu-Gi-Oh! Card Database - ygoprodeck. illusion , azamina , white forest . Its a combo Deck that was OTK potential but can also go first. very consistent combo deck , multiple lines and extenders 2 days ago · About Press Copyright Contact us Creators Advertise Developers Terms Privacy Policy & Safety How YouTube works Test new features NFL Sunday Ticket Press Copyright TCG Februar 2025 Schimäre Deck von Jonespro98 · 43 Karten · 15 Extra Deck · 15 Side Deck Illusion Chimera Budget. Decks; Non-Meta Decks; Runick Illusion Chimera; Runick Illusion Chimera. Check out this Chimera deck profile, followed by three duels where the deck shines. Chimera the Illusion beast is an extremly broken card, with the addition of Nightmare Apprentice you can easily guarantee he can gain an additional 3 attacks which is game usually. Non-Meta Decks Bystial Branded "C" 40. Xenovia. TCG Dezember 2024 · Erstellt von Download YDK YDKE Test Hand Export Deck Export Master Duel/Neuron Export Deck PDF Price Breakdown Deckbuilder Download Proxies Download all Images Deck Primer Chimera Illusionist Dualist Nexus (May 2023) Sep 17, 2023 · Learn how to play with Chimera, the new fusion deck which introduces a new monster type to the game, Illusion monsters. Side Deck . So far the Chimera cards have an anti target negate and a negate for a monster effect on the field if they control Chimera. Apprentice also allows a consistant way to summon Chaos Angel! This season I decided to climb to Master I with Chimera, a deck which is a lot of fun to play both going 1st and 2nd. Guardian Chimera. Follow: Twitch: https://www. twitch. 69 / Cardmarket €133. Illusion Chimera 2024 - Alfonso44. there's a new illusion monster i think works well with the deck. dzeikyymnklcmeraqqsigfqlefsiameafbcgailmabwueakjyrshbruitgeydlgrrussfmibmi